• USA Home
  • AV32466 - Anti-PCAF antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV32466 Sigma-Aldrich

Anti-PCAF antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-p300/CBP-associated factor

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Chromatin Remodeling, Antibodies for Epigenetics and Nuclear Signaling,
species reactivity   human, dog, guinea pig, rat, mouse, horse, bovine, rabbit
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   IgG fraction of antiserum
form   buffered aqueous solution
mol wt   mol wt 93 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PCAF(8850)
biological source   rabbit
antibody product type   primary antibodies
conjugate   unconjugated
NCBI accession no.   NP_003875
UniProt accession no.   Q92831

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human PCAF

General description

PCAF is a histone acetylase that functions as a nuclear receptor coactivator. Studies have reported that PCAF acetylates p53 sites in vitro.
Rabbit Anti-PCAF antibody recognizes rat, bovine, chicken, zebrafish, canine, mouse, and human PCAF.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Application

Rabbit Anti-PCAF antibody can be used for western blot applications at a concentration of 2.5μg/ml.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. PCAF associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.

Sequence

Synthetic peptide located within the following region: LFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAK

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?