• USA Home
  • AV38234 - Anti-SOX4 antibody produced in rabbit

AV38234 Sigma-Aldrich

Anti-SOX4 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-EVI16, Anti-SRY (sex determining region Y)-box 4

  •  NACRES NA.41



Related Categories Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, Primary Antibodies,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   guinea pig, dog, human, bovine, rat, rabbit, mouse
mol wt   47 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
Quality Level   100
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_003098
UniProt accession no.   Q06945
Gene Information   human ... SOX4(6659)


General description

SRγ (sex determining region γ) (SOX) are HMG box containing transcription factors that bind to the minor groove of DNA. Sox proteins family members regulate a variety of aspects of development. SRγ (sex determining region γ)-box 4 (SOX4, EVI16, SRγ) is required for differentiation and proliferation in many tissues, including various cancers. Sox4 acts in part by stabilizing β-catenin. Sox4 is required for lymphocyte development. It is an early factor in B-cell differentiation.

SRY (sex determining region Y) (SOX) are high-mobility-group (HMG) box containing transcription factors, that binds to the minor groove of DNA. SRY box 4 (SOX4) is a member of the SOX family of transcription factors. It is expressed majorly in normal and neoplastic gut tissues. SOX4 gene is located on human chromosome 6p22.3.


Anti-SOX4 polyclonal antibody reacts with bovine, canine, human, mouse, rat, zebrafish, and chicken SRγ (sex determining region γ)-box 4 proteins.


Synthetic peptide directed towards the N terminal region of human SOX4


Anti-SOX4 polyclonal antibody is used to tag SRγ (sex determining region γ)-box 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of SRγ (sex determining region γ)-box 4 in cell differentiation and proliferation, such as B-cell differentitation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

SRY box 4 (SOX4) is required for differentiation and proliferation in many tissues, including various cancers. It stabilizes β-catenin. Sox4 is essential for lymphocyte development. It acts as an early factor in B-cell differentiation. SOX4 is involved in the regulation of embryonic development and the determination of cell fate. It acts as a transcriptional regulator after forming syndecan binding protein (syntenin), a protein complex. SOX4 modulates the apoptosis pathway, which leads to cell death and tumorigenesis. It regulates downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development.


Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA

Safety & Documentation

Safety Information

NONH for all modes of transport
WGK Germany 


Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles


Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy


Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?