• USA Home
  • AV40225 - Anti-EXOSC10 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV40225 Sigma-Aldrich

Anti-EXOSC10 antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-Exosome component 10

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Epigenetics and Nuclear Signaling, Antibodies for Gene Regulation,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   human
mol wt   mol wt 97 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_002676
UniProt accession no.   Q01780
Gene Information   human ... EXOSC10(5394)

Description

General description

Exosome complex (RNAse complex), a complex of 3′ -→ 5′ exoribonucleases, is a multi-protein complex that degrades various types of ribonucleic acids (RNA). Exosome component 10 (EXOSC10, PMSCL2, "polymyositis/scleroderma autoantigen 2, 100kDa) is an exoribonuclease that shares sequence similarity to budding yeast Rrp6 and is proposed to catalyze 3′-to-5′ exoribonuclease activity on a variety of nuclear transcripts including ribosomal RNA subunits, RNA that has been poly-adenylated by TRAMP, as well as other nuclear RNA transcripts destined for processing and/or destruction.

Specificity

Anti-EXOSC10 polyclonal antibody reacts with human, mouse, rat, and bovine polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human EXOSC10

Application

Anti-EXOSC10 polyclonal antibody is used to tag polymyositis/scleroderma autoantigen 2, 100kDa for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) in the function of specific exosomes.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

EXOSC10 contains 1 HRDC domain and 1 3′-5′ exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

Sequence

Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?