• USA Home
  • AV40625 - Anti-GNB2L1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV40625 Sigma-Aldrich

Anti-GNB2L1 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1

Purchase

Properties

species reactivity   mouse, bovine, guinea pig, rat, human, sheep, dog, rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 35 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... GNB2L1(10399)
biological source   rabbit
antibody product type   primary antibodies
conjugate   unconjugated
NCBI accession no.   NP_006089
UniProt accession no.   P63244

Description

Immunogen

Synthetic peptide directed towards the C terminal region of human GNB2L1

General description

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stable housekeeping gene expressed in alveolar macrophage and neutrophils. The gene has been hypothesized to encode a protein RACK1 (Receptor for activated C kinase 1). It is mapped on the telomeric position of chromosome 5q35.3.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Specificity

Anti-GNB2L1 polyclonal antibody reacts with canine, human, mouse, rat, pig, zebrafish, and chicken guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 proteins.

Application

Anti-GNB2L1 polyclonal antibody is used to tag guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the expression of guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 in macrophages and neutrophils.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a scaffold protein highly involved in the binding and anchorage of protein kinase C. It has been hypothesized that GNB2L1 may act as a regulatory cofactor of multidrug resistance protein 3 (MDR3/ABCB4) and is vital for the plasma membrane localization and for mediating the translocation function of ABCB4.

Sequence

Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?