• USA Home
  • AV40847 - Anti-LARP7 antibody produced in rabbit

AV40847 Sigma-Aldrich

Anti-LARP7 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-DKFZP564K112, Anti-HDCMA18P, Anti-La ribonucleoprotein domain family, member 7, Anti-MGC104360



Related Categories Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to RNA Binding Proteins, L-LL,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   bovine, horse, rat, human, canine, guinea pig, rabbit, mouse
mol wt   67 kDa
form   lyophilized powder
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_056269
UniProt accession no.   Q4G0J3
Gene Information   human ... LARP7(51574)


General description

La ribonucleoprotein domain family, member 7 (LARP7), a 7SK binding protein, is involved in small nuclear ribonucleoprotein (snRNP) 7SK-mediated regulation of transcription. LARP7 is a negative transcriptional regulator of polymerase II genes by mechanisms that involves the 7SK-RNP system. Down regulation of LARP7 may promote gastric tumorigenesis via p-TEFb dysregulation.


Anti-LARP7 polyclonal antibody reacts with chicken, human, mouse, rat, bovine, and canine La ribonucleoprotein domain family, member 7 proteins.


The immunogen for anti-LARP7 antibody: synthetic peptide derected towards the C terminal of human LARP7


Anti-LARP7 polyclonal antibody is used to tag La ribonucleoprotein domain family, member 7 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of La ribonucleoprotein domain family, member 7 in 7SK-RNP (ribonucleoprotein) system regulation of transcription

Physical form

Lyophilized from PBS buffer with 2% sucrose


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD

Safety & Documentation

Safety Information

NONH for all modes of transport
WGK Germany 
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable


Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles


Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy


Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?