• USA Home
  • AV41251 - Anti-FZD7 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV41251 Sigma-Aldrich

Anti-FZD7 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-Frizzled homolog 7 (Drosophila)

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Neurobiology, Antibodies to Wnt Signaling, FP-FZ,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   guinea pig, canine, human, mouse, rabbit, rat
mol wt   63 kDa
form   lyophilized powder
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_003498
UniProt accession no.   O75084
Gene Information   human ... FZD7(8324)

Description

General description

Frizzled homolog 7 (Drosophila) (Fzd7) is a member of the Frizzled (Fzd) receptor family involved in canonical Wnt signaling. Fzd7 is involved in the regulation of stem cell development and various types of cancers including colorectal cancer, hepatocellular carcinoma and triple negative breast cancer (TNBC).

Specificity

Anti-FZD7 polyclonal antibody reacts with mouse, rat, chicken, canine, and human Frizzled homolog 7 proteins.

Immunogen

The immunogen for anti-FZD7 antibody: synthetic peptide derected towards the C terminal of human FZD7

Application

Anti-FZD7 polyclonal antibody is used to tag Frizzled homolog 7 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of Frizzled homolog 7 in Wnt signaling involved in stem call and cancer development.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sequence

Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number

Certificate of Origin (COO)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?