• USA Home
  • AV41333 - Anti-DCX (AB1) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV41333 Sigma-Aldrich

Anti-DCX (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-DBCN, Anti-DC, Anti-Doublecortex; lissencephaly, X-linked (doublecortin), Anti-LISX, Anti-SCLH, Anti-XLIS

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Neurobiology, Antibodies to Neural Proteins, DA-DD,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   human, mouse, rat
mol wt   40 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_835364
UniProt accession no.   O43602
Gene Information   human ... DCX(1641)

Description

Immunogen

Synthetic peptide directed towards the C terminal region of human DCX

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. DCX is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The protein contains two doublecortin domains, which bind microtubules. In addition, DCX interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex.In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The protein encoded by this gene is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The encoded protein contains two doublecortin domains, which bind microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene are a cause of X-linked lissencephaly. Multiple transcript variants encoding at least three different isoforms have been found for this gene.

Sequence

Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?