• USA Home
  • AV41516 - Anti-SLC22A1 (AB1) antibody produced in rabbit

AV41516 Sigma-Aldrich

Anti-SLC22A1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-1-Oct, Anti-HOCT1, Anti-Oct1_cds, Anti-Solute carrier family 22 (organic cation transporter), member 1

  •  NACRES NA.41



Related Categories Alphabetical Index, Antibodies, Antibodies to Drug Transport Proteins, Biochemicals and Reagents, Drug Transport Proteins & Reagents,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   bovine, dog, mouse, rabbit, guinea pig, horse, rat, human
mol wt   61 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
Quality Level   100
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_694857
UniProt accession no.   Q9NQD4
Gene Information   human ... SLC22A1(6580)


General description

Solute carrier family 22 (organic cation transporter), member 1 (SLC22A1, 1-Oct, HOCT1, Oct1-cds) is a transporter of organic cations (OCT) that in addition to endogenous cations include various external origin cationic toxins and drugs. Examples of drugs transported by OCT1 include metformin, amantadine, pramipexole, and, possibly, levodopa.


Anti-SLC22A1 (AB1) polyclonal antibody reacts with chicken, pig, bovine, rabbit, human, mouse, rat, and canine solute carrier family 22 (organic cation transporter), member 1 proteins.


Synthetic peptide directed towards the N terminal region of human SLC22A1


Anti-SLC22A1 (AB1) polyclonal antibody is used to tag solute carrier family 22 (organic cation transporter), member 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 22 (organic cation transporter), member 1 in the transport of small organic cations including a variety of important drugs.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.


Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

Safety & Documentation

Safety Information

NONH for all modes of transport
WGK Germany 


Certificate of Analysis (COA)

Please Enter a Lot Number

Certificate of Origin (COO)

Please Enter a Lot Number
Protocols & Articles


Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy


Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?