• USA Home
  • AV41675 - Anti-CYP2D6 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV41675 Sigma-Aldrich

Anti-CYP2D6 antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-CPD6, Anti-CYP2D, Anti-CYP2D@, Anti-CYP2DL1, Anti-Cytochrome P450, family 2, subfamily D, polypeptide 6, Anti-MGC120389, Anti-MGC120390, Anti-RP4-669P10.2

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CT-CZ, Primary Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   rat, human
mol wt   mol wt 55 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_000097
UniProt accession no.   P10635
Gene Information   human ... CYP2D6(1565)

Description

General description

Anti-CγP2D6 polyclonal antibody reacts with pig, rabbit, human, mouse, rat, and zebrafish cytochrome P450, family 2, subfamily D, polypeptide 6 proteins.

Cytochrome P450, family 2, subfamily D, polypeptide 6 (CγP2D6) is an important oxidizing enzyme involved in drug metabolism wherein it sometimes functions as a drug activator. CγP2D6 metabolizes drugs in important classes including antidepressants (tricyclics, tetracyclics, SSRIs, SNRIs); opioids; antipsychotics; β-blockers; class I antiarrhythmics and a variety of other drug applications.

Immunogen

Synthetic peptide directed towards the N terminal region of human CYP2D6

Application

Anti-CγP2D6 polyclonal antibody is used to tag cytochrome P450, family 2, subfamily D, polypeptide 6 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cytochrome P450, family 2, subfamily D, polypeptide 6 proteins in metabolism of many important therapeutic drugs.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme′s substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Sequence

Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Phase I Drug Metabolism

Phase I biotransformation reactions introduce or expose functional groups on the drug with the goal of increasing the polarity of the compound. Although Phase I drug metabolism occurs in most tissues...
Robert Gates
Biofiles Volume 6 Article 1
Keywords: Catalysis, Eliminations, Environmental, Enzyme-linked immunosorbent assay, Gastrointestinal, Gene expression, Immunohistochemistry, Metabolism, Metabolites, Oxidations, Post translational modifications, Reductions, Support, Western blot

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?