• USA Home
  • AV42248 - Anti-SLC6A8 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV42248 Sigma-Aldrich

Anti-SLC6A8 antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-CRTR, Anti-CT1, Anti-MGC87396, Anti-Solute carrier family 6 (neurotransmitter transporter, creatine), member 8

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Drug Transport Proteins, Biochemicals and Reagents, Drug Transport Proteins & Reagents,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   horse, human, mouse, guinea pig, bovine, rat, dog
mol wt   70 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_001136277
UniProt accession no.   P48029
Gene Information   human ... SLC6A8(6535)

Description

General description

Solute carrier family 6 (neurotransmitter transporter, creatine), member 8/sodium- and chloride-dependent creatine transporter 1 (SLC6A8, CRTR, CT1) is required for the cellular uptake of creatine, which facilitates the storage of energy as ATP. Defects in SLC6A8/CRTR leads to creatine-deficiency syndrome evidenced by mental retardation and language delay.

Specificity

Anti-SLC6A8 polyclonal antibody reacts with bovine, canine, human, mouse, rat, pig, and rabbit sodium- and chloride-dependent creatine transporter 1 proteins

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC6A8

Application

Anti-SLC6A8 polyclonal antibody is used to tag solute carrier family 6 (neurotransmitter transporter, creatine), member 8for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 6 (neurotransmitter transporter, creatine), member 8 in creatine homeostasis and the development of creatine-deficiency syndrome.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

SLC6A8 is required for the uptake of creatine in muscles and brain.

Sequence

Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?