• USA Home
  • AV42254 - Anti-PBEF1 (AB1) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV42254 Sigma-Aldrich

Anti-PBEF1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-1110035O14Rik, Anti-DKFZP666B131, Anti-MGC117256, Anti-NAMPT, Anti-PBEF, Anti-Pre-B-cell colony enhancing factor 1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Obesity Research, Antibodies to Hormones,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   rabbit, mouse, guinea pig, rat, horse, human, dog, bovine
mol wt   54 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_005737
UniProt accession no.   P43490
Gene Information   human ... PBEF1(10135)

Description

General description

Pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase (PBEF1, NAMPT, visfatin) is a rate limiting enzyme that promotes the salvage pathway biosynthesis of nicotinamide mononucleotide and nicotinamide dinucleotide (NAD) by catalyzing the condenstation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate. PBEF1 promotes B-cell maturation and vascular smooth muscle cell differentiaton. Visfatin/PBEF/Nampt is also a proinflammatory cytokine and marker of adipose tissue associated with systemic insulin resistance and hyperlipidemia. PBEF1 is a potential malignant astrocytoma serum marker and prognostic indicator among glioblastoma (GBM).

Specificity

Anti-PBEF1 (AB1) polyclonal antibody reacts with chicken, zebrafish, human, mouse, rat, canine, and pig pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human PBEF1

Application

Anti-PBEF1 (AB1) polyclonal antibody is used to tag pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin in adipose tissue inflammation, as a cancer serum marker and as an NAD biosynthesis salvage pathway enzyme.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

Sequence

Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?