• USA Home
  • AV43008 - Anti-UBE2D2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV43008 Sigma-Aldrich

Anti-UBE2D2 antibody produced in rabbit

IgG fraction of antiserum, lyophilized powder

Synonym: Anti-Ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Anti-E2(17)KB2, Anti-PUBC1, Anti-UBC4/5, Anti-UBC4, Anti-UBCH5B

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, U1-UG
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   mouse, canine, rabbit, zebrafish, horse, bovine, human, rat
mol wt   60 kDa
form   lyophilized powder
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
immunogen sequence   TISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
NCBI accession no.   NP_862821
UniProt accession no.   P62837
Gene Information   human ... UBE2D2(7322)

Description

General description

Ubiquitination modifies and targets proteins for degradation via the proteosome. Ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2, PUBC1, UBCH5B, UBC4/5, UBC4) is an E2 ubiquitin-conjugating enzyme involved in the ubiquitination of cell regulatory proteins such as tumor-suppressor protein p53 and I kappaB α. UBCH5B supports Mdm2-mediated ubiquitination of p53 and SCF(β TrCP2) E3 ubiquitin (Ub) ligase ubiquitination of I kappaB α.

Specificity

Anti-UBE2D2 polyclonal antibody reacts with canine, human, mouse, rat, bovine, and zebrafish ubiquitin-conjugating enzyme E2D 2 proteins.

Immunogen

synthetic peptide corresponding to a region of human UBE2D2 with an internal ID of S13006

Application

Anti-UBE2D2 polyclonal antibody is used to tag ubiquitin-conjugating enzyme E2D 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of ubiquitin-conjugating enzyme E2D 2 in the proteosomal degradation of important regulatory molecules such as p53 and I kappaB α.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?