• USA Home
  • AV43838 - Anti-SLC7A1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV43838 Sigma-Aldrich

Anti-SLC7A1 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-ATRC1, Anti-CAT-1, Anti-ERR, Anti-HCAT1, Anti-REC1L, Anti-Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Drug Transport Proteins, Biochemicals and Reagents, Drug Transport Proteins & Reagents,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   human, rabbit, bovine
mol wt   68 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_003036
UniProt accession no.   P30825
Gene Information   human ... SLC7A1(6541)

Description

General description

Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1/ high affinity cationic amino acid transporter 1 (SLC7A1, ATRC1, CAT-1, ERR, REC1L) is a y+ system cationic amino acid transporter family member that supports arginine uptake and nitric oxide (NO) production. Mouse CAT-1 is a viral receptor for ecotropic murine leukemia virus (MLV) (eMLV), making it a model for study of retrovirus infection mechanisms and pathogenesis.

Specificity

Anti-SLC7A1 polyclonal antibody reacts with human and pig solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC7A1

Application

Anti-SLC7A1 polyclonal antibody is used to tag Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 in cationic amino acid uptake and retrovirus infection mechanisms and pathogenesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.

Sequence

Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?