• USA Home
  • AV44167 - Anti-SLC19A1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV44167 Sigma-Aldrich

Anti-SLC19A1 antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-CHMD, Anti-FOLT, Anti-IFC1, Anti-REFC, Anti-RFC1, Anti-Solute carrier family 19 (folate transporter), member 1

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Drug Transport Proteins, Biochemicals and Reagents, Drug Transport Proteins & Reagents,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   human
mol wt   65 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_919231
UniProt accession no.   P41440
Gene Information   human ... SLC19A1(6573)

Description

General description

Solute carrier family 19 (folate transporter), member 1 (SLC19A1, CHMD, FOLT, RFC1, IFC1) is a major carrier-mediated transporter in mammalian cells for the uptake of reduced folates and antifolate-based anticancer drugs such as methotrexate. RFC activity can be considered as a potential marker for predicting response to antifolate chemotherapy.

Specificity

Anti-SLC19A1 polyclonal antibody reacts with human solute carrier family 19 (folate transporter), member 1.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC19A1

Application

Anti-SLC19A1 polyclonal antibody is used to tag solute carrier family 19 (folate transporter), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 19 (folate transporter), member 19 in carrier-mediated reduced folate uptake.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?