• USA Home
  • AV45752 - Anti-SOD1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV45752 Sigma-Aldrich

Anti-SOD1 antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-ALS1, Anti-ALS, Anti-Homodimer, Anti-IPOA, Anti-SOD, Anti-SuPeroxide dismutase 1, soluble (aMyotrophic lateral sclerosis 1 (adult))

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Cell Stress, Antibodies to Oxidative Stress Proteins,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   human
mol wt   16 kDa
form   lyophilized powder
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_000445
UniProt accession no.   P00441
Gene Information   human ... SOD1(6647)

Description

General description

Superoxide dismutase 1, soluble (aMyotrophic lateral sclerosis 1 (adult)) (SOD1, ALS1, ALS, IPOA, SOD) is a copper-zinc enzyme that destroys free superoxide radicals in the cytoplasm and mitochondrial inter-membrane space of cells. Mutated SOD1 is linked to familial amyotrophic lateral sclerosis (ALS).

Specificity

Anti-SOD1 polyclonal antibody reacts with human superoxide dismutase 1.

Immunogen

The immunogen for anti-SOD1 antibody: synthetic peptide derected towards the N terminal of human SOD1

Application

Anti-SOD1 polyclonal antibody is used to tag superoxide dismutase 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of superoxide dismutase 1 in cellular oxidative stress defense and as a causative agent in familial amyotrophic lateral sclerosis (ALS).

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sequence

Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?