• USA Home
  • AV46303 - Anti-PSAT1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV46303 Sigma-Aldrich

Anti-PSAT1 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym: Anti-EPIP, Anti-MGC1460, Anti-PSA, Anti-PSAT, Anti-PhosphoSerine aminotransferase 1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PS-PS, Primary Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   mouse, rat, rabbit, bovine, canine, human, zebrafish, horse, rabbit
mol wt   40 kDa
form   lyophilized powder
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
immunogen sequence   SAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETV
NCBI accession no.   NP_066977
UniProt accession no.   Q9Y617
Gene Information   human ... PSAT1(29968)

Description

Immunogen

synthetic peptide corresponding to a region of human PSAT1 with an internal ID of S17901

Application

Anti-PSAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

PSAT1 (PhosphoSerine aminotransferase 1) gene also referred to as EPIP, MGC1460, PSA or PSAT encodes for an enzyme involved in the phosphorylated pathway of L-serine biosynthesis. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. Additionally, overexpression of PSAT1 induces cell growth and cancer progression as well as escalates chemoresistance of colon cancer cells.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?