• USA Home
  • AV47057 - Anti-LAPTM4A antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV47057 Sigma-Aldrich

Anti-LAPTM4A antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-Lysosomal-associated protein transmembrane 4 α, Anti-KIAA0108, Anti-LAPTM4, Anti-MBNT, Anti-Mtrp

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, L-LL, Primary Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   rat, rabbit, mouse, bovine, guinea pig, human, horse, dog
mol wt   27 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_055528
UniProt accession no.   Q15012
Gene Information   human ... LAPTM4A(9741)

Description

General description

LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Immunogen

Synthetic peptide directed towards the middle region of human LAPTM4A

Application

Anti-LAPTM4A antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Sequence

Synthetic peptide located within the following region: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?