• USA Home
  • AV47613 - Anti-PSMC3IP antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV47613 Sigma-Aldrich

Anti-PSMC3IP antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-GT198, Anti-HOP2, Anti-PSMC3 interacting protein, Anti-TBPIP

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PS-PS, Primary Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   horse, human, dog
mol wt   25 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_037422
UniProt accession no.   Q9P2W1
Gene Information   human ... PSMC3IP(29893)

Description

General description

PSMC3IP (HOP2) forms a part of the PSMC3IP/MND1 complex that associates with PSMC3/TBP1 and regulates strand exchange during meiotic recombination. A mutation in PSMC3IP has been associated with XX ovarian dysgenesis.
Rabbit anti- PSMC3IP antibody recognizes canine, human, bovine, rat, and mouse PSMC3IP.

Immunogen

Synthetic peptide directed towards the middle region of human PSMC3IP

Application

Rabbit anti- PSMC3IP antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

PSMC3IP plays an important role in meiotic recombination. It stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. It may inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.

Sequence

Synthetic peptide located within the following region: RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?