• USA Home
  • AV48150 - Anti-P4HB (AB1) antibody produced in rabbit

AV48150 Sigma-Aldrich

Anti-P4HB (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-Procollagen-Proline, 2-oxoglutarate 4-dioxygenase, β polypeptide, Anti-DSI, Anti-ERBA2L, Anti-GIT, Anti-PDI, Anti-PDIA1, Anti-PHDB, Anti-PO4DB

  •  NACRES NA.41



Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to Adhesion Molecules and Related Proteins, Antibodies to Cell and Organelle Proteins,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: suitable
  western blot: suitable
species reactivity   rabbit, bovine, rat, human, mouse, horse
mol wt   55 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
Quality Level   100
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_000909
UniProt accession no.   P07237
Gene Information   human ... P4HB(5034)


General description

Prolyl 4-hydroxylase, beta polypeptide (P4HB) is a disulphide isomerase that catalyzes the creation, cleavage and arrangement of disulfide linkages. It is known to function as a chaperone during protein folding activities. Studies have reported that P3HB-b-P4HB block copolymers have a better yield and tensile strength.
Rabbit Anti-P4HB antibody recognizes bovine, chicken, rabbit, human, mouse, and rat P4HB.


Synthetic peptide directed towards the N terminal region of human P4HB


Rabbit Anti-P4HB antibody is suitable for western blot applications at a dilution of 1:2000 and for IHC at 4-8ug/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.This gene encodes the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV

Safety & Documentation

Safety Information

NONH for all modes of transport
WGK Germany 


Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles


Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy


Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?