• USA Home
  • AV49648 - Anti-CDH22 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV49648 Sigma-Aldrich

Anti-CDH22 antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-C20orf25, Anti-Cadherin-like 22, Anti-MGC39564, Anti-dJ998H6.1

  •  NACRES NA.41

Purchase

Properties

conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   mouse, human, rat, dog, guinea pig, horse, rabbit, bovine
mol wt   73 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   IgG fraction of antiserum
Quality Level   100
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_067071
UniProt accession no.   Q9UJ99
Gene Information   human ... CDH22(64405)

Description

General description

Cadherin 22, type 2 (CDH22) belongs to cadherin family. Cadherins are transmembrane proteins. They contain an extracellular domain responsible for cell-cell binding, a transmembrane domain and a cytoplasmic domain.

Immunogen

Synthetic peptide directed towards the N terminal region of human CDH22

Application

Anti-CDH22 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

Cadherin 22, type 2 (CDH22) is a calcium-dependent cell adhesion protein expressed highly in the brain. Functions of CDH22 include morphogenesis in neural and non-neural cells during the development of brain and the neuroendocrine organs. CDH22 interacts directly with PRL3 (Protein-tyrosine phosphatase of regenerating liver 3), gene responsible for promotion of epithelial mesenchymal transition. PRL3 results in down-regulation of CDH22 expression. CDH22 is up-regulated in colorectal cancer and lymphatic metastasis of colorectal carcinoma. Absence of CDH22 partially suppresses proliferation of colorectal cancer cells.

Sequence

Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?