• USA Home
  • AV50153 - Anti-PCDH15 antibody produced in rabbit

AV50153 Sigma-Aldrich

Anti-PCDH15 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-DFNB23, Anti-DKFZp667A1711, Anti-Protocadherin 15, Anti-RP11-449J3.2, Anti-USH1F



Related Categories Alphabetical Index, Antibodies, PB-PC, Primary Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   rabbit, guinea pig, rat, human, mouse, bovine
mol wt   80 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_149045
UniProt accession no.   A2A3E5
Gene Information   human ... PCDH15(65217)


General description

The gene Protocadherin-related 15 (PCDH15) is mapped to human chromosme 10q21.1. It is an integral membrane protein and one of the members of the cadherin superfamily that mediate calcium-dependent cell-cell adhesion.. PCDH15 transcripts can be detected in adult brain, lung, kidney, fetal retina and fetal cochlea.


Synthetic peptide directed towards the N terminal region of human PCDH15


Anti-PCDH15 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

The expression of Protocadherin-related 15 (PCDH15) is essential for normal function of cochlea and retina. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). PCDH15 is expressed in nasal NK/T-cell lymphomas.


Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP

Safety & Documentation

Safety Information

NONH for all modes of transport
WGK Germany 


Certificate of Analysis

Protocols & Articles


Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy


Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?