• USA Home
  • AV54777 - Anti-LDHA antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV54777 Sigma-Aldrich

Anti-LDHA antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-LDH-M, Anti-LDH1, Anti-Lactate dehydrogenase A, Anti-PIG19

Purchase

Properties

Related Categories Aerobic Glycolysis (the Warburg Effect), Alphabetical Index, Antibodies, Antibodies Against Proteins Involved in Glucose Metabolism, Cancer Metabolism,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   horse, human, rabbit, zebrafish, rabbit, guinea pig
mol wt   mol wt 37 kDa
form   lyophilized powder
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_001128711
UniProt accession no.   P00338
Gene Information   human ... LDHA(3939)

Description

Immunogen

Synthetic peptide directed towards the middle region of human LDHA

Application

Anti-LDHA antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

LDHA gene encodes an enzyme Lactate dehydrogenase A that belongs to LDH/MDH superfamily and LDH family. It is widely expressed in muscle tissue and facilitates the catalysis of L-lactate and NAD to pyruvate and NADH, the final step of anaerobic glycolysis. Defects in LDHA gene is associated with exertional myoglobinuria (myoglobinuria occurs due to intense anaerobic exercise).

Sequence

Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Milli-Q® Water Purification Solutions
Protocols & Articles

Articles

Aerobic Glycolysis and the Warburg Effect

The Warburg effect is the enhanced conversion of glucose to lactate observed in tumor cells, even in the presence of normal levels of oxygen. Otto Heinrich Warburg demonstrated in 1924 that cancer ce...
Keywords: Aerobic, Cancer, Cell proliferation, Clinical, Glycolysis, PAGE, Phosphorylations, Transcription

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?