• USA Home
  • HPA000288 - Anti-ACE2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA000288 Sigma-Aldrich

Anti-ACE2 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Angiotensin-converting enzyme 2 precursor antibody produced in rabbit, Anti-Angiotensin-converting enzyme homolog antibody produced in rabbit, Anti-ACE-related carboxypeptidase antibody produced in rabbit, Anti-ACEH antibody produced in rabbit

Purchase

Properties

Related Categories A-AD, AC-AC, Alphabetical Index, Antibodies, Prestige Antibodies,
product line   Prestige Antibodies® Powered by Atlas Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:500-1:1000
species reactivity   human
enhanced validation   orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
Quality Level   100
antibody product type   primary antibodies
immunogen sequence   MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
UniProt accession no.   Q9BYF1
Gene Information   human ... ACE2(59272)

Description

General description

Angiotensin-converting enzyme 2 (ACE2) is mapped to human chromosome Xp22.2. It is a homolog of ACE and shares 42% sequence identity. ACE2 is expressed in kidney, gastrointestinal and cardiovascular tissues.

Angiotensin-converting enzyme-2 (ACE2) is a homolog of angiotensin-I converting enzyme (ACE). ACE2 is a member of the renin-angiotensin system (RAS) which performs functions similar to carboxypeptidase. This 805 amino acid protein is localized in human kidney. The ACE2 gene is located at human chromosome Xp22.2. It contains a N-terminal peptidase domain (PD) and the C-terminal collectrin-like domain (CLD).

Immunogen

Angiotensin-converting enzyme 2 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Anti-ACE2 antibody produced in rabbit has been used for immunohistochemistry at a dilution of 1:500-1:1000. It has also been used in western blotting at a working concentration of 0.04-0.4 μg/ml.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

Angiotensin-converting enzyme (ACE2) catalyzes the degradation of angiotensin (Ang) II to Ang (1-7). The deficiency ACE2 or its inhibition by ang II is implicated in the pathogenesis of cardiac hypertrophy and myocardial dysfunction. ACE2 is multifunctional and is incapable of hydrolyzing bradykinin. In patients with CTD (connective tissue disease), serum autoantibodies suppress ACE2, which leads to a decrease in the physiological levels of vasoprotective agent Ang (1-7) in the vascular milieu. Activation or administration of ACE2 in patients with CTD may serve as a therapeutic method for treating pulmonary arterial hypertension (PAH), or persistent digital ischemia. It also plays a regulatory role in lung diseases and pulmonary fibrosis. The human ACE2 receptor is recognized by severe acute respiratory syndrome (SARS-CoV) coronaviruses (CoVs) 2. This interaction paves a way for the transmission of infection.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74018.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 1
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number

Certificate of Origin (COO)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Coronavirus COVID-19 (SARS-CoV-2) Detection, Characterization, Vaccine and Therapy Production

As a global life science supplier, we are here to help in the response to COVID-19. From supplying raw materials and research products for detection and characterization to production, we’ve consolid...
Keywords: PAGE

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?