• USA Home
  • HPA001200 - Anti-EGFR antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA001200 Sigma-Aldrich

Anti-EGFR antibody produced in rabbit

Antibody Enhanced Validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Epidermal growth factor receptor precursor antibody produced in rabbit, Anti-Receptor tyrosine-protein kinase ErbB-1 antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Kinase/Phosphatase Biology, Antibodies to Cytokines and Growth Factors,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: 1:50-1:200
species reactivity   human
enhanced validation   orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
Featured Industry   Research Pathology
UniProt accession no.   P00533
Gene Information   human ... EGFR(1956)

Description

General description

The gene epidermal growth factor receptor (EGFR) is mapped to human chromosome 7p12. It belongs to receptor tyrosine kinase family. The protein is mainly localized in the plasma membrane.

Immunogen

Epidermal growth factor receptor precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-EGFR antibody produced in rabbit is suitable for use in epitope mapping to study the antibody cross-reactivity with a multi-target fragment library.
Anti-EGFR antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

Epidermal growth factor receptor (EGFR) plays an important role in cell proliferation, survival, and differentiation. Interaction between EGFR and its ligands results in stimulation of several transduction pathways including the RAS/RAF/MEK/MAPK, PLC-γ/PKC, PI3K/AKT, JAK/STAT, and NF-κB cascades. Presence of ligand stimulates EGFR phosphorylation. This event subsequently recruits ubiquitin ligase, CBL, to EGFR. Activated EGFR-ligand complex is removed from the cell surface via endocytosis and is degraded in the lysosomes to attenuate the signaling. EGFR hyper-phosphorylation is linked to cell proliferation and thereby tumor development. EGFR is associated with a number of human solid tumors, including lung, breast, prostate, bladder, colon, head and neck, ovarian and salivary duct carcinomas.
Density-enhanced phosphatase-1 (DEP1) dephosphorylates and thereby stabilizes EGFR. The transmembrane protein LRIG1 and suppressors of cytokine signaling-5 (SOCS5) binds and destabilizes EGFR. Protein tyrosine phosphatase PTPN3 and PHD3 promotes EGFR endocytic degradation.

Linkage

Corresponding Antigen APREST78874.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1

Documents

Certificate of Analysis

Please Enter a Lot Number

Certificate of Origin

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Prestige Antibodies® in Breast Cancer Research

The Human Protein Atlas (HPA) project was initiated in 2003 by Swedish researchers, headed by Professor Mathias Uhlén, and funded by the Knut and Alice Wallenberg Foundation.1,2 It is a unique world ...
Keywords: AGE, Amplification, Angiogenesis, Apoptosis, Autophagy, Calcification, Cancer, Cell disruption, Cell proliferation, Central Nervous System, Clinical, Confocal microscopy, Deposition, Diagnostic, Diseases, Electron capture detector, Electrophoresis, Enzyme-linked immunosorbent assay, Functional genomics, Gastrointestinal, Gel electrophoresis, Gene expression, Genetics, Genomics, Growth factors, Hormones, Immunocytochemistry, Immunohistochemistry, In Situ hybridization, Ligands, Metabolism, Microarray Analysis, Microscopy, Nucleic acid hybridization, Oncology, Proteomics, Purification, Reductions, Sequencing, Tissue microarrays, Transcription, Western blot, transformation

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

related product

Product #

Description

Add to Cart

E2156 Monoclonal Anti-EGF Receptor antibody produced in mouse, clone 225, purified from hybridoma cell culture
E1282 Anti-Epidermal Growth Factor Receptor antibody produced in goat, affinity isolated antibody, lyophilized powder
E1157 Anti-Epidermal Growth Factor Receptor/Erb B1 antibody produced in goat, affinity isolated antibody, lyophilized powder
E0532 Monoclonal Anti-Epidermal Growth Factor Receptor antibody produced in mouse, clone 102618, purified immunoglobulin, lyophilized powder
E2760 Monoclonal Anti-Epidermal Growth Factor Receptor antibody produced in mouse, clone 29.1, ascites fluid
E3641 Epidermal Growth Factor Receptor human, buffered aqueous glycerol solution, 5,000-30,000 units/mg protein (Lowry)
E3138 Monoclonal Anti-Epidermal Growth Factor Receptor antibody produced in mouse, clone F4, ascites fluid
E2645 Epidermal Growth Factor Receptor human, lyophilized powder, ≥15,000 units/mg protein (Bradford)

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?