• USA Home
  • HPA001216 - Anti-PIK3R1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA001216 Sigma-Aldrich

Anti-PIK3R1 antibody produced in rabbit

Antibody Enhanced Validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Phosphatidylinositol 3-kinase regulatory subunit α antibody produced in rabbit, Anti-PI3-kinase p85-subunit α antibody produced in rabbit, Anti-PI3K antibody produced in rabbit, Anti-PtdIns-3-kinase p85-α antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PG-PO, PH-PI, Prestige Antibodies,
species reactivity   human
application(s)   immunoblotting: 0.4 μg/mL
  immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:50- 1:200
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PIK3R1(5295)
biological source   rabbit
antibody product type   primary antibodies
enhanced validation   Recombinant Expression
Learn more about Antibody Enhanced Validation
conjugate   unconjugated
UniProt accession no.   P27986

Description

Immunogen

Phosphatidylinositol 3-kinase regulatory subunit α recombinant protein epitope signature tag (PrEST)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Anti-PIK3R1 antibody produced in rabbit has been used in western blotting.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST78872.

Biochem/physiol Actions

PIK3R1 (phosphoinositide-3-kinase, regulatory subunit 1) gene encodes the 85kDa regulatory subunit of phosphatidylinositol 3-kinase. The enzyme contains a 110kDa catalytic subunit that phosphorylates inositol ring of phosphatidylinositol at the 3′ position. It is essential for the insulin-stimulated increase in glucose uptake and glycogen synthesis in tissues that are insulin-sensitive. Mutation in this gene causes SHORT syndrome characterized by short stature, hyperextensibility of joints, ocular depression, Rieger anomaly and teething delay.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Oncogenes and Tumor Suppressors Reprogram Metabolism

Proliferating cells require the biosynthesis of structural components for biomass production and for genomic replication. This requires a reprogramming of the metabolic pathways to ensure nutrients s...
Keywords: Aerobic, Antitumor agents, Apoptosis, Biofiles, Cancer, Citric Acid Cycle, Degradations, Environmental, Events, Gene expression, Glycolysis, Growth factors, Metabolic Pathways, Metabolism, Metabolites, Nucleotide Synthesis, PAGE, Pentose phosphate pathway, Phosphorylations, Support

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?