• USA Home
  • HPA001432 - Anti-HSD17B10 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA001432 Sigma-Aldrich

Anti-HSD17B10 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-3-Hydroxy-2-methylbutyryl-CoA dehydrogenase antibody produced in rabbit, Anti-3-Hydroxyacyl-CoA dehydrogenase type II antibody produced in rabbit, Anti-3-Hydroxyacyl-CoA dehydrogenase type-2 antibody produced in rabbit, Anti-Endoplasmic reticulum-associated amyloid β-peptide-binding protein antibody produced in rabbit, Anti-Type II HADH antibody produced in rabbit, Anti-Type II HADH

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, H, HP-HT, Prestige Antibodies,
species reactivity   human
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:50- 1:200
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   EAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQA
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... HSD17B10(3028)
biological source   rabbit
antibody product type   primary antibodies
conjugate   unconjugated
UniProt accession no.   Q99714

Description

Immunogen

3-Hydroxyacyl-CoA dehydrogenase type-2 recombinant protein epitope signature tag (PrEST)

General description

HSD17B10 (hydroxysteroid (17-b) dehydrogenase 10) gene encodes a mitochondrial, multifunctional protein, 17β-hydroxysteroid dehydrogenase type 10. It is a homotetrameric protein belonging to the short-chain dehydrogenase/reductase superfamily.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

Anti-HSD17B10 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST74041.

Biochem/physiol Actions

HSD17B10 (hydroxysteroid (17-β) dehydrogenase 10) is involved in the metabolism of fatty acids and steroid. It catalyzes the 2-methyl-3-hydroxybutyryl-CoA dehydrogenation (MHBD) reaction in isoleucine metabolism. It is a subunit of mitochondrial ribonuclease P and functions in the maturation of mitochondrial tRNA. It catalyzes the oxidation of several fatty acids and steroids. Defects in this gene cause 17β-hydroxysteroid dehydrogenase type 10 (HSD10) deficiency, that is characterized by progressive psychomotor regression and alteration of mitochondria morphology. It has been reported that HSD17B10 shows clinical importance in Alzheimer disease.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Mitochondrial Dysfunction and Metabolic Defects

Defects in mitochondrial function are associated with insulin resistance in both human and animal studies. Insulin resistance is associated with a decrease in the number, oxidative capacity, size, an...
Keywords: Acetylations, Apoptosis, Biofiles, Cancer, Carboxylations, Catalog, Catalysis, Citric Acid Cycle, Decarboxylations, Degradations, Diabetes, Enzyme-linked immunosorbent assay, Glycolysis, Immunofluorescence, Immunohistochemistry, Lipid Metabolism, Metabolism, Metabolites, Neurotransmitters, Obesity, Oxidations, Phosphorylations, Physiological Processes, Protocols, Transcription, Transduction, Transfection, Western blot

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?