• USA Home
  • HPA002891 - Anti-AKT1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA002891 Sigma-Aldrich

Anti-AKT1 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-C-AKT antibody produced in rabbit, Anti-PKB antibody produced in rabbit, Anti-Protein kinase B antibody produced in rabbit, Anti-RAC-α serine/threonine-protein kinase antibody produced in rabbit, Anti-RAC-PK-α antibody produced in rabbit

Purchase

Properties

Related Categories AE-AK, AF-AP, AKT Antibodies, AKT1 Antibodies, Alphabetical Index,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:50- 1:200
species reactivity   human
enhanced validation   orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA
UniProt accession no.   P31749
Gene Information   human ... AKT1(207)

Description

General description

AKT1 (v-akt murine thymoma viral oncogene homolog 1) is a Ser/Thr protein kinase, and is also called protein kinase B (PKB). This protein is activated when it is phosphorylated at serine 473 and threonine 308. This gene is localized to human chromosome 14q32.32.

Immunogen

RAC-α serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

RAC-α is an enzyme encoded by the AKT1 gene in humans. The Akt/tuberin/mTOR pathway plays an important role in the regulation of DNA damage and repair pathways that may predispose diabetic kidneys to pathogenesis of renal cell carcinoma. The pathway is also critically involved in cancer cell growth, invasion and survival.

Linkage

Corresponding Antigen APREST70574.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?