• USA Home
  • HPA004943 - Anti-SLCO1B3 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA004943 Sigma-Aldrich

Anti-SLCO1B3 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-LST-2, Anti-Liver-specific organic anion transporter 2, Anti-OATP8, Anti-Organic anion transporter 8, Anti-Organic anion-transporting polypeptide 8, Anti-Solute carrier family 21 member 8, Anti-Solute carrier organic anion transporter family member 1B3

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Drug Transport Proteins, Biochemicals and Reagents, Drug Transport Proteins & Reagents,
product line   Prestige Antibodies® Powered by Atlas Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:1000-1:2500
  western blot: 0.4 μg/mL
species reactivity   human
enhanced validation   recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
immunogen sequence   QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
UniProt accession no.   Q9NPD5
Gene Information   human ... SLCO1B3(28234)

Description

General description

The organic anion transporting polypeptides (OATPS) are membrane bound transporters belonging to the SLC (solute carrier) superfamily. SLCO1B3 (solute carrier organic anion transporter family, member 1B3) or OATP1B3 is a drug transporter, which belongs to the OATP1B subfamily. It is expressed in hepatocytes at the basolateral membrane. SLCO1B3 gene has two major single nucleotide polymorphisms (SNP) at exon 3 and 6, and these polymorphic variations determine the characteristics of the transportations of various substrates. The gene is located in the chromosomal region 12p12.

Immunogen

Solute carrier organic anion transporter family member 1B3 recombinant protein epitope signature tag (PrEST)

Application

Anti-SLCO1B3 antibody is suitable for immunocytochemistry.
Anti-SLCO1B3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

SLCO1B3 (solute carrier organic anion transporter family, member 1B3) plays a major role in the uptake and clearance of a broad range of drugs and drug metabolites in liver. SLCO1B3 is also responsible for the uptake of the cancer drugs- paclitaxel and docetaxel. It has been suggested that, in humans, ABCC3, OATP1B1, and SLCO1B3 form a liver- blood shuttle, where ABCC3 secretes the bilirubin glucoronide conjugates in the blood, which is then reabsorbed back to liver by OATP1B1 and SLCO1B3. Any deficiency in SLCO1B3 may therefore, be implicated in Rotor Syndrome or Rotor type hyperbilirubinemia. It mediates uptake of steroid hormones such as testosterone, and is found to be overexpressed in prostate cancer tissue as compared to normal tissue. SNPs in the gene SLCO1B3 determine the prognosis and survival in prostate cancer patients.

Linkage

Corresponding Antigen APREST86073.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?