• USA Home
  • HPA005456 - Anti-ARID1A antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA005456 Sigma-Aldrich

Anti-ARID1A antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: ARID1A Antibody - Anti-ARID1A antibody produced in rabbit, Anti-B120 antibody produced in rabbit, Anti-BAF250, Anti-BAF250a, Anti-C10rf4, Anti-C1orf4, Anti-P270, Anti-SMARCF1, Arid1A Antibody

Purchase

Properties

Related Categories AA - CA, AQ-AZ, AR-AR, Alphabetical Index, Antibodies,
species reactivity   human
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:200-1:500
  western blot: 0.4 μg/mL
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... ARID1A(8289)
biological source   rabbit
antibody product type   primary antibodies
enhanced validation   RNAi knockdown
Learn more about Antibody Enhanced Validation
conjugate   unconjugated
Featured Industry   Research Pathology
UniProt accession no.   O14497

Description

Immunogen

AT-rich interactive domain-containing protein 1A recombinant protein epitope signature tag (PrEST)

Sequence
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

General description

AT-rich interactive domain-containing protein 1A (ARID1A) is a member of ARID family, which forms a subunit of SWI/SNF (SWItch/Sucrose NonFermentable) chromatin-remodeling complex. It is a tumor suppressor gene, and binds to DNA in a non-sequence specific manner. This gene is located in the chromosomal region 1p36.11. AIRD1A is also called BAF250a, which is one of the two highly conserved isoforms of BAF250/AIRD1. It is a trithorax group (TrxG) protein, and is highly expressed in pre-implantation embryo and embryonic stem (ES) cells.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST70748.

Biochem/physiol Actions

AT-rich interactive domain 1A (ARID1A) interacts with Brahma-related gene-1 (BRG1) adenosine triphosphate and forms the SWI/SNF complex. It targets the SWI/SNF complex to the specific genes, and helps bind it to the DNA in a sequence non-specific manner. During gastrulation, it plays an essential role in proper germ-layer formation. It also helps maintain the embryonic stem (ES) cell stage and is responsible for the differentiation of cardiomyocytes. Because AIRD1A acts as a tumor suppressor gene, its inactivation has been implicated in various cancers, such as epithelial, ovarian and endometrial carcinomas. It is also linked to gastric cancer and has potential as a marker for the prognosis of patients with early stage gastric cancer.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?