• USA Home
  • HPA005480 - Anti-SYVN1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA005480 Sigma-Aldrich

Anti-SYVN1 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-DER3, Anti-HRD1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to E1,E2,E3 Ligase, Antibodies to Protein Degradation,
species reactivity   human
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:20- 1:50
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... SYVN1(84447)
biological source   rabbit
antibody product type   primary antibodies
enhanced validation   orthogonal RNAseq
Learn more about Antibody Enhanced Validation
conjugate   unconjugated
UniProt accession no.   Q86TM6

Description

Immunogen

E3 ubiquitin-protein ligase synoviolin precursor recombinant protein epitope signature tag (PrEST)

General description

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) is a part of ER-associated degradation (ERAD) and is an E3 ubiquitin ligase. It localizes to endoplasmic reticulum (ER) and is ubiquitously expressed. It is highly expressed in skeletal muscle, pancreas and liver. SYVN1 contains six domains, which span the plasma membrane. It is a non-glycosylated protein and has a cytoplasmic RING-H2 finger domain. This gene is located on chromosome 11q13.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

Anti-SYVN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST70751.

Biochem/physiol Actions

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) plays a key role in various processes, such as embryogenesis or negative regulation of tumor suppressor gene p53. The expression of SYVN1 is induced by IRE1 and ATF6, during ER stress, where it protects against ER-stress induced cell apoptosis. It is a part of endoplasmic reticulum associated degradation (ERAD) and degrades 3-hydroxy-3-methylglutaryl-coenzyme A, along with TCR-α and CD3-δ, which are ERAD substrates. It also sequesters p53, in the cytoplasm, and ubiquitinates it. Thus, it represses the various activities of p53, such as cell cycle regulation and apoptosis. SYVN1 is responsible for maintaining joint homeostasis and hence, is involved in the pathogenesis of arthropathy. In rheumatoid arthritis, it is overexpressed in synovial cells, leading to a ′hyper-ERAD′ state. It interacts with, and degrades tau and phosphorylated tau (p-tau). Therefore, it prevents tau-induced cytotoxicity and helps neuronal survival.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?