• USA Home
  • HPA005544 - Anti-MTA1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA005544 Sigma

Anti-MTA1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Metastasis-associated protein MTA1 antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies in Chromatin Remodeling, Antibodies to Most Studied Epigenetic Genes, Antibodies to Remodeling Complex,
species reactivity   human
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:200- 1:500
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   LEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... MTA1(9112)
biological source   rabbit
conjugate   unconjugated

Description

Immunogen

Metastasis-associated protein MTA1 recombinant protein epitope signature tag (PrEST)

General description

Metastasis tumor antigen 1 (MTA1) is a part of the nucleosome remodeling and deacetylating (NuRD) complex, and is also a candidate member for the metastasis-associated family of genes. MTA1 is localized to chromosomal position 14q32.3. This protein is localized in the nucleus. It has a molecular weight of ~82kDa and consists of 715 amino acids. The C-terminus of MTA1 consists of a proline-rich region or the SH3 (SRC homology 3)-binding domain. It is also composed of a leucine zipper, a putative DNA-binding zinc finger motif and five SPXX motifs.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST70514.

Biochem/physiol Actions

Metastasis tumor antigen 1 (MTA1) is a gene related to the progression of cancer. Its expression is up-regulated in various cancers, such as liver, breast, ovarian and colorectal cancer. As a component of nucleosome remodeling and deacetylating (NuRD) complex, it is thought to play a role in transcription control and chromatin remodeling. It acts as a repressor of estrogen receptor α (ERα), and an activator of Breast Cancer Amplified Sequence 3 (BCAS3). BCAS3 gene is overexpressed in breast cancers, and hence, MTA1 might play a role in tumorigenesis of breast cancer. MTA1 activates paired box gene 5 (Pax5), which in turn is up-regulated in B-cell lymphomas. Hence, MTA1 might be involved in lymphogenesis. When up-regulated in cells, this protein leads to chromosomal instability and aberrant number of centrosomes. This is achieved by the suppression of BRCA1, which is a tumor suppressor gene.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Search & filter by validated application (ie, WB, IF/ICC, IHC, ELISA, etc,) host species, clonality (monoclonal, polyclonal and recombinant) and more. Learn from technical information, product highli...
Keywords: Amplification, Buffers, Enzyme-linked immunosorbent assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?