• USA Home
  • HPA005781 - Anti-TACC3 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA005781 Sigma-Aldrich

Anti-TACC3 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-ERIC-1, Anti-Transforming acidic coiled-coil-containing protein 3

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary Antibodies,
species reactivity   human
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:50- 1:200
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... TACC3(10460)
biological source   rabbit
antibody product type   primary antibodies
enhanced validation   RNAi knockdown
Learn more about Antibody Enhanced Validation
conjugate   unconjugated
UniProt accession no.   Q9Y6A5

Description

Immunogen

Transforming acidic coiled-coil-containing protein 3 recombinant protein epitope signature tag (PrEST)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

Anti-TACC3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST70194.

Biochem/physiol Actions

Transforming acidic coiled-coil-containing protein 3 is a protein encoded by the TACC3 gene in humans. It is referred as ERIC1 and ERIC-1. It is a member of the human transforming acidic coiled-coil (TACC) family of centrosomal adaptor proteins. It plays a critical role in microtubule nucleation at the centrosome. It is involved in the regulation of microtubule nucleation at the centrosome and functions in the stabilization of the γ-tubulin ring complex assembly. It plays an essential role in spindle assembly and centrosome integrity during mitosis as well as for cellular survival. It may act as a potential therapeutic target in cancer cells. It is aberrantly expressed in a variety of human cancers. It acts as a driver of tumorigenesis as well as an inducer of oncogenic EMT.

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Prestige Antibodies® in Breast Cancer Research

The Human Protein Atlas (HPA) project was initiated in 2003 by Swedish researchers, headed by Professor Mathias Uhlén, and funded by the Knut and Alice Wallenberg Foundation.1,2 It is a unique world ...
Keywords: AGE, Amplification, Angiogenesis, Apoptosis, Autophagy, Calcification, Cancer, Cell disruption, Cell proliferation, Central Nervous System, Clinical, Confocal microscopy, Deposition, Diagnostic, Diseases, Electron capture detector, Electrophoresis, Enzyme-linked immunosorbent assay, Functional genomics, Gastrointestinal, Gel electrophoresis, Gene expression, Genetics, Genomics, Growth factors, Hormones, Immunocytochemistry, Immunohistochemistry, In Situ hybridization, Ligands, Metabolism, Microarray Analysis, Microscopy, Nucleic acid hybridization, Oncology, Proteomics, Purification, Reductions, Sequencing, Tissue microarrays, Transcription, Western blot, transformation

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?