• USA Home
  • HPA010592 - Anti-CD74 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA010592 Sigma-Aldrich

Anti-CD74 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-CD74 antigen antibody produced in rabbit, Anti-HLA class II histocompatibility antigen γ-chain antibody produced in rabbit, Anti-HLA-DR antigens-associated invariant chain antibody produced in rabbit, Anti-Ia antigen-associated invariant chain antibody produced in rabbit, Anti-Ii antibody produced in rabbit, Anti-p33 antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Analytical Cytology, Antibodies, Antibodies for Cell Biology, Antibodies for Immune Cell Signaling and Blood,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:500- 1:1000
species reactivity   human
enhanced validation   orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK
Featured Industry   Research Pathology
UniProt accession no.   P04233
Gene Information   human ... CD74(972)

Description

General description

CD74 (cluster of differentiation 74) is the invariant chain of MHC (major histocompatibility) complex class II. It was the first receptor to be recognized for macrophage migration inhibitory factor (MIF). It is a membrane receptor.

Immunogen

HLA class II histocompatibility antigen γ-chain recombinant protein epitope signature tag (PrEST)

Application

Anti-CD74 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

CD74 (cluster of differentiation 74) acts as the chaperone of MHC-II (major histocompatibility) and is responsible for the trafficking of MHC-II molecules in APCs (antigen presenting cells). It also interacts with non-MHC proteins and functions as a receptor for MIF (macrophage migration inhibitory factor). MIF is a pleiotropic cytokine having pro-tumorigenic and pro-inflammatory functionality. It is involved in the progression and metastasis of hematologic and solid cancers, and its up-regulation in thyroid cancer might be linked with advanced tumor stage. In patients with malignant pleural mesothelioma, the over-expression of this protein functions as an independent prognostic marker for overall survival.

Linkage

Corresponding Antigen APREST71660.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???

Certificate of Origin

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?