• USA Home
  • HPA010917 - Anti-TREM2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA010917 Sigma-Aldrich

Anti-TREM2 antibody produced in rabbit

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-TREM-2 antibody produced in rabbit, Anti-Triggering receptor expressed on monocytes 2 antibody produced in rabbit, Anti-Triggering receptor expressed on myeloid cells 2 precursor antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary Antibodies,
product line   Prestige Antibodies® Powered by Atlas Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
species reactivity   human
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
immunogen sequence   AAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
UniProt accession no.   Q9NZC2
Gene Information   human ... TREM2(54209)

Description

General description

TREM2 (triggering receptor expressed on myeloid cells 2) belongs to the immunoglobulin (Ig) family, and is a transmembrane receptor. It has an extracellular region containing the Ig-like domain and has a cytoplasmic tail. TREM2 protein is composed of 230 amino acids, which consists of a signal peptide of 13 amino acids, 154 amino acids extracellular region, a transmembrane region of 33 amino acids succeeded by a cytoplasmic tail of 30 amino acids. This gene is localized to human chromosome 6p21.1. It is expressed on myeloid cells such as, macrophages found in tissue and dendritic cells. It is also expressed on microglial cells in brain, which are the predominant innate neuroimmune cells.

Immunogen

Triggering receptor expressed on myeloid cells 2 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-TREM2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

TREM2 (triggering receptor expressed on myeloid cells 2) performs phagocytosis of bacteria and is involved in regulation of inflammatory responses. As it is expressed on microglia, it is responsible for the clearance of neural debris on microglia. Microglia is responsible for the phagocytosis, degradation and clearance of Amyloid β peptide (Aβ) in brain. TREM2 suppresses the ability of microglia to phagocytize Aβ, and disturbs the pro-inflammatory activity of these cells. Parkinson′s disease (PD) is characterized by the degeneration of dopaminergic neurons, in the substantia nigra pars compacta region of the brain. TREM2 binds directly to the ligands expressed by these dopaminergic neurons. Also, microgliosis is also involved in the progression of PD. Therefore, variations in TREM2 gene might be linked to susceptibility to PD. p.R47H polymorphism in this gene is related to increased risk of sporadic amyotrophic lateral sclerosis. Mutations in this gene are also linked with polycystic lipomembranous osteodysplaysia with sclerosing leukoencephalopathy.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
• Validated for multiple commonly used applications such as IHC (Immunohistochemistry), IF (Immunofluorescence), and WB (Western Blot)

Linkage

Corresponding Antigen APREST71705.

Safety & Documentation

Safety Information

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number

Certificate of Origin (COO)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?