• USA Home
  • HPA011216 - Anti-CD207 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA011216 Sigma-Aldrich

Anti-CD207 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-C-type lectin domain family 4 member K antibody produced in rabbit, Anti-CD207 antigen antibody produced in rabbit, Anti-Langerin antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CD-CL, CD0-CDC, Prestige Antibodies,
species reactivity   human
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:20- 1:50
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... CD207(50489)
biological source   rabbit
antibody product type   primary antibodies
enhanced validation   orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
conjugate   unconjugated
UniProt accession no.   Q9UJ71

Description

Immunogen

C-type lectin domain family 4 member K recombinant protein epitope signature tag (PrEST)

General description

Langerin (CD207) is a C-type lectin, which is expressed on Langerhans cells. It contains a C-type carbohydrate recognition domain (CRD) in its extracellular region. It also contains a Ca2+-dependent sugar binding region. It is a type II transmembrane protein, and its extracellular region also contains the neck region. This neck region forms coiled-coils of α-helices which give rise to oligomers of CD207. It contains a proline-rich motif (WPREPPP) in its intracellular domain, which in turn is composed of 43 amino acids. This proline-rich motif might be involved in signal transduction. CD207 gene is localized to human chromosome 2p13.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST71827.

Biochem/physiol Actions

Langerin (CD207) is an endocytic receptor which is involved in the formation of Birbeck granules, which are a part of the endosomal compartments exclusive to Langerhans cells. It recognizes the surface glucoconjugates present on pathogens such as, human immunodeficiency virus (HIV), and internalizes them into Birbeck granules. It therefore, prevents the transfer of HIV from Langerhans cells to T-cells, by degrading it. It forms the first step in antigen processing and presentation to immune cells. It recognizes a wide range of pathogens such as, Mycobacterium leprae, herpes simplex virus 2, and fungi such as, Malassezia furfur and Candida species. CD207 also binds to measles virus and presents it to CD4+ T cells.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?