• USA Home
  • HPA011332 - Anti-IGF2R antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA011332 Sigma-Aldrich

Anti-IGF2R antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-300 kDa mannose 6-phosphate, Anti-Cation-independent mannose-6-phosphate receptor precursor, Anti-CI Man-6-P receptor, Anti-CI-MPR, Anti-IGF-II receptor, Anti-Insulin-like growth factor 2 receptor, Anti-Insulin-like growth factor II receptor, Anti-M6P/IGF2 receptor, Anti-M6P/IGF2R, Anti-M6PR

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, I-IG, I-J, Prestige Antibodies,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:200- 1:500
species reactivity   human
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE
UniProt accession no.   P11717
Gene Information   human ... IGF2R(3482)

Description

General description

IGF2R (insulin-like growth factor 2 receptor) is a transmembrane glycoprotein. It is one of the two mannose 6-phosphate (M6P) receptors found in mammalian cells. It has 15 consecutive repeating regions making up a repetitive structure. The domains 3 and 9 contain M6P-binding sites. Domain 5 contains M6P-N-acetylglucosamine residue- binding site. The IGF-II binding site is located in domain 11. It belongs to p-lectin family and has a molecular weight of 300kDa. It has an N-terminal, a small cytosolic C-terminal, a transmembrane region and a large exosolic domain.

Immunogen

Cation-independent mannose-6-phosphate receptor precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-IGF2R antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

IGF2R (insulin-like growth factor 2 receptor) regulates multiple cellular processes such as, cell survival, proliferation, migration and invasion, endocytosis, lysosomal trafficking. Its ligands are divided in two major classes- mannose 6-phosphate (M6P)-containing and non-M6P. The former class includes lysosomal acid hydrolases, TGF (transforming growth factor)-β, proliferin, thyroglobulin, and granzyme B, while the latter class includes mitogen, plasminogen, insulin-like growth factor II (IGF-II) and retinoic acid. Binding of plasminogen to IGF2R leads to the conversion and activation of plasminogen to plasmin. This gene is also mutated in multiple cancers where it might lead to tumorigenesis. It is down-regulated in breast cancer where it supposedly facilitates tumorigenesis. It decreases the metastatic capacity of receptor-deficient SCC-VII squamous cell carcinoma cells, which in turn is modulated by M6P-binding site within domain 3.

Linkage

Corresponding Antigen APREST86865.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???

Certificate of Origin

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?