• USA Home
  • HPA013898 - Anti-WNT10A antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA013898 Sigma-Aldrich

Anti-WNT10A antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Protein Wnt-10a precursor

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary Antibodies,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: 1:50- 1:200
species reactivity   human
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   YESPIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSR
UniProt accession no.   Q9GZT5
Gene Information   human ... WNT10A(80326)

Description

General description

The gene WNT10A (wingless-type MMTV integration site family member 10A) encodes a member of the WNT gene family, the members of which are secreted signaling proteins. The encoded protein spans a length of 417 amino acids and contains a WNT core domain. The gene is clustered along with WNT6 gene in a head-to-tail manner interspaced with 7kb segment on human chromosome 2q35. It is highly expressed in fetal kidney, placenta, adult spleen and kidney. It is found to be coexpressed with WNT6 in colorectal cancer. It is also found to be expressed in promyelocytic leukemia and Burkitt′s lymphoma.

Immunogen

Protein Wnt-10a precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

The protein encoded by the gene WNT10A (wingless-type MMTV integration site family member 10A) may be involved in the inhibition of adipogenesis as its expression is found to be downregulated during the development of white adipocytes. It is found to stabilize β-catenin and stimulate osteoblastogenesis. It regulates the fate of mesenchymal stem cell (MSC). Mutations in this gene has been linked to Odonto-onycho-dermal dysplasia, an autosomal recessive syndrome, characterized by dry hair, severe hypodontia, smooth tongue with marked reduction of fungiform and filiform papillae, onychodysplasia, keratoderma and hyperhidrosis of palms and soles, and hyperkeratosis of the skin.

Linkage

Corresponding Antigen APREST71978.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???

Certificate of Origin

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?