• USA Home
  • HPA014849 - Anti-KCNE3 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA014849 Sigma-Aldrich

Anti-KCNE3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-MinK-related peptide 2, Anti-Minimum potassium ion channel-related peptide 2, Anti-Potassium channel subunit beta MiRP2, Anti-Potassium voltage-gated channel subfamily E member 3

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, K, K-KH, Prestige Antibodies,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunohistochemistry: 1:1000- 1:2500
species reactivity   human
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
UniProt accession no.   Q9Y6H6
Gene Information   human ... KCNE3(10008)

Description

General description

KCNE3 (potassium channel, voltage gated subfamily E regulatory β subunit 3) encodes the β subunit of potassium channel, which associates with multiple α subunits, to form a channel complex. This gene is localized to human chromosome 11q13-14, and is expressed in brain, inner ear and heart. It belongs to the KCNE family, which contains five members, from KCNE1-5.

Immunogen

Potassium voltage-gated channel subfamily E member 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST72451.

Biochem/physiol Actions

KCNE3 (potassium channel, voltage gated subfamily E regulatory β subunit 3) interacts with KCNE1, to control the transport, surface expression and activation of KCNH3, a potassium channel, in cortex and other regions of the central nervous system (CNS). Its chromosomal location is the locus for autosomal recessive, non-syndromal hearing disorder. It acts as an inhibitory β- subunit, and regulates the activity of Kv4.3 channel. Mutation in this gene is associated with Brugada-pattern electrocardiogram (ECG) and neurally mediated syncope (NMS). Thus, it might have some role in the pathogenesis of Brugada syndrome (BrS). Variants in this gene are also linked to long QT syndrome (LQTS), which is an inherited disorder. This protein also interacts with Kv7.1, which results in acceleration in the activation and decay of the current.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?