• USA Home
  • HPA015267 - Anti-CDK14 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA015267 Sigma-Aldrich

Anti-CDK14 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Serine/threonine-protein kinase PFTAIRE-1, Anti-PFTK1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CD-CL, PD-PG, Prestige Antibodies,
species reactivity   human
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:20- 1:50
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PFTK1(5218)
biological source   rabbit
antibody product type   primary antibodies
conjugate   unconjugated

Description

Immunogen

Serine/threonine-protein kinase PFTAIRE-1 recombinant protein epitope signature tag (PrEST)

General description

CDK14 (cyclin-dependent kinase 14) belongs to a 21 member cyclin dependent kinase gene family. It is also called PFTK1 or PFTAIRE1. This family contains two groups- 10 classical CDKs and the rest 11 are members of a new group. This gene is localized to human chromosome 7q21.13, and has a high expression level in brain, heart, pancreas, kidney, ovaries and testis. In lungs, it is expressed in bronchial and alveolar epithelium.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

Anti-CDK14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST73464.

Biochem/physiol Actions

CDK14 (cyclin-dependent kinase 14) facilitates cell division, and also has functions as an oncogene. In hepatocellular carcinoma, it aids in tumor growth and metastasis. It is overexpressed in esophageal squamous cell carcinoma (ESCC), and this is related to poor response to chemotherapy. It has potential as a marker for prognosis as well as response to chemotherapy in ESCC. Studies in mice show that cigarette smoke leads to reduced expression of this protein in both testicular and lung cells. In lungs, this results in decreased β-catenin, resulting in aberrant Wnt signaling. Studies in mice also show that this protein is involved in meiosis and differentiation of neuronal cells. It phosphorylates caldesmon, an actin-binding protein, and thus facilitates the binding of actin molecules, and the formation of stress fibers.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?