• USA Home
  • HPA018142 - Anti-SETDB1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA018142 Sigma-Aldrich

Anti-SETDB1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-ESET, Anti-KG1T, Anti-KIAA0067, Anti-KMT1E, Anti-TDRD21

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Histones, Antibodies to Most Studied Epigenetic Genes,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:200- 1:500
species reactivity   human
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   KLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRPNMGAVRSKGPVVQYTQD
UniProt accession no.   Q15047
Gene Information   human ... SETDB1(9869)

Description

General description

The gene SET domain bifurcated-1 (SETDB1) is located in human chromosome 1 (1q21). The encoded protein contains a DNA methyl binding domain and catalytic SET domain at the N- and C-terminus respectively. In non­-small lung cancer cells SETDB1 is present mainly in the nucleus, with additional cytoplasmic expression. Similarly, mouse embryos showed SETDB1 signal in the nucleus.

Immunogen

Histone-lysine N-methyltransferase SETDB1 recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST73723.

Biochem/physiol Actions

SET domain bifurcated-1 (SETDB1) is responsible for methylation of histone 3 lysine-9 in euchromatic region, resulting in a repressed transcription mark. During DNA replication, it is recruited by Methyl-CpG-binding domain protein-1 (MBD1) and forms a replication coupled complex with chromatin assemble factor CAF-1 to methylate lysine-9 at the newly deposited histone 3. The gene is up-regulated in glioma tissues, melanomas, non-small and small lung cancers. SETDB1 undergoes gene amplification in lung tumorigenesis. Higher expression causes stimulation of WNT-β-catenin pathway and down-regulation of P53 expression, resulting in enhanced non-small cell lung cancer growth. Role of SETDB1 in cancer is also suggested by its association with the promyelocytic nuclear leukemia-nuclear bodies and increased expression in broncoepithelial cells. SETDB1 is involved in proviral silencing during embryogenesis when DNA methylation is dynamically reprogrammed.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?