• USA Home
  • HPA018525 - Anti-BNC2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA018525 Sigma

Anti-BNC2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Zinc finger protein basonuclin-2

Purchase

Properties

Related Categories AA - CA, Alphabetical Index, Antibodies, Antibodies to Transcription Factors, B,
species reactivity   human
application(s)   immunohistochemistry: 1:200- 1:500
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   YENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKKSFKSSYSVK
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... BNC2(54796)
biological source   rabbit
conjugate   unconjugated

Description

Immunogen

Zinc finger protein basonuclin-2 recombinant protein epitope signature tag (PrEST)

General description

The gene basonuclin-2 (BNC2) is mapped to human chromosome 9p22. It belongs to basonuclin zinc-finger family of transcription factors. BNC2 transcripts are mainly present in tissues of the reproductive system (ovary and testis), kidney and skin. The protein is localized in the nucleus.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST73749.

Biochem/physiol Actions

Basonuclin-2 (BNC2) is associated with skin color variation and skin cancer risk. It also contributes to the occurrence of facial pigmented spots during aging. BNC2 has been shown to be associated with epithelial ovarian cancer. Knockdown of BNC2 causes distal urethral defects in mouse model.

Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Search & filter by validated application (ie, WB, IF/ICC, IHC, ELISA, etc,) host species, clonality (monoclonal, polyclonal and recombinant) and more. Learn from technical information, product highli...
Keywords: Amplification, Buffers, Enzyme-linked immunosorbent assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?