• USA Home
  • HPA026761 - Anti-EPCAM antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA026761 Sigma-Aldrich

Anti-EPCAM antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti Epcam, Anti-Tumor-associated calcium signal transducer 1, Anti-CD326 antigen, Anti-EGP, Anti-Epcam, Anti-Epithelial cell surface antigen, Anti-Epithelial glycoprotein, Anti-KS 1/4 antigen, Anti-KSA, Anti-Major gastrointestinal tumor-associated protein GA733-2, Epcam Antibody - Anti-EPCAM antibody produced in rabbit, Epcam Antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Breast Cancer Stem Cell Markers, Cancer Research, Cancer Stem Cells,
product line   Prestige Antibodies® Powered by Atlas Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:200- 1:500
species reactivity   human
enhanced validation   orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
immunogen sequence   LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY
UniProt accession no.   P16422
Gene Information   human ... EPCAM(4072)

Description

General description

Epithelial cell adhesion molecule (EpCAM) gene, also referred to as TACSTD (tumor-associated calcium signal transducer) 1, is mapped to human chromosome 2p21, a region composed of the mutS homolog 2 (MSH2) and mutS homolog 6 (MSH6) DNA mismatch repair genes. The gene codes for a membrane-associated glycoprotein expressed in epithelial cells of different organs.

Immunogen

Tumor-associated calcium signal transducer 1 Precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-EPCAM antibody produced in rabbit has been used in proximity ligation assay to study the interaction between EpCAM and AGR2 (anterior gradient-2 ) proteins.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

Epithelial cell adhesion molecule (EpCAM) might function as a hepatic stem/progenitor cell-specific marker. EpCAM is an oncogene activated by deliverance of its intracellular domain, which is involved in transducing signals into the cell nucleus by associating with elements of the wnt pathway. Since the epithelial cell adhesion molecule (EpCAM) is highly expressed in premalignant hepatic tissues and in a subset of hepatocellular carcinoma (HCC), it might act as an early biomarker of hepatocellular carcinoma (HCC). EpCAM gene mutation leads to a rare autosomal recessive diarrheal disorder in infants called congenital tufting enteropathy (CTE). Like other cell adhesion molecules, EpCAM plays a crucial role in cell-cell interaction and it is also associated with tight junction protein, like claudin-7. Experimental studies hypothesize that EpCAM is involved in normal intestinal and crypt villus axis development .

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
• Validated for multiple commonly used applications such as IHC (Immunohistochemistry), IF (Immunofluorescence), and WB (Western Blot)

Linkage

Corresponding Antigen APREST70142.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?