• USA Home
  • HPA031149 - Anti-CD200 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA031149 Sigma-Aldrich

Anti-CD200 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-CD200 molecule, Anti-MOX1, Anti-MOX2, Anti-MRC, Anti-OX-2, Anti-ST1C1, Anti-SULT1C1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CD-CL, CD0-CDC, Prestige Antibodies,
species reactivity   human
application(s)   immunohistochemistry: 1:50- 1:200
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... CD200(4345)
biological source   rabbit
antibody product type   primary antibodies
enhanced validation   orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
conjugate   unconjugated
UniProt accession no.   P41217

Description

Immunogen

CD200 molecule recombinant protein epitope signature tag (PrEST)

General description

CD200 (CD_antigen 200) gene is mapped to human chromosome 3q13.2. The gene encodes a transmembrane glycoprotein that belongs to the immunoglobulin superfamily. CD200 is widely expressed in different tissues and cell types such as lymphocytes, kidney glomeruli, neurons and endothelial cells. Its receptor is mainly expressed by myeloid cells (granulocytes, monocytes and macrophages).

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Anti-CD200 antibody produced in rabbit has been used in immunofluorescence.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST86190.

Biochem/physiol Actions

CD200 (CD_antigen 200) has an immunosuppressive effect on cells expressing its receptor, CD200R. CD200 is involved in maintaining immune homeostasis. CD200 reduces the immune system′s reaction to vaccines, while inhibition of CD200 expression can enhance the efficacy of cancer immunotherapy. The gene is known to be overexpressed in a number of human cancers. CD200 mostly supports tumor growth and invasion, by suppressing anti-tumor immune responses, while it is also known to inhibit melanoma cells from forming tumors or metastasizing into the lung. CD200 is considered as a biomarker in colon cancer and cutaneous squamous cell carcinoma. Deficiency of CD200 results in hyperactivation of macrophages and enhanced immune response to autoimmune disease.

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?