• USA Home
  • HPA035248 - Anti-IDH1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA035248 Sigma-Aldrich

Anti-IDH1 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-isocitrate dehydrogenase 1 (NADP+), soluble, Idh1 Antibody - Anti-IDH1 antibody produced in rabbit, Idh1 Antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies Against Proteins Involved in the IDH Pathway, Cancer Metabolism, Cancer Research,
species reactivity   human, mouse, rat
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:500- 1:1000
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... IDH1(3417)
biological source   rabbit
antibody product type   primary antibodies
enhanced validation   orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation
conjugate   unconjugated
UniProt accession no.   O75874

Description

Immunogen

isocitrate dehydrogenase 1 (NADP+), soluble recombinant protein epitope signature tag (PrEST)

General description

The gene IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) is mapped to human chromosome 2q33. The protein is present in the cytoplasm and peroxisomes.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-IDH1 antibody produced in rabbit has been used in western blotting.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST79089.

Biochem/physiol Actions

IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) participates in the TCA (tricarboxylic acid) cycle. It is responsible for the formation of α-ketoglutarate (αKG) by oxidative decarboxylation of isocitrate, thereby resulting in the generation of NADPH (nicotinamide adenine dinucleotide phosphate). IDH1 helps in glucose sensing, glutamine metabolism, lipogenesis and controlling cellular redox condition. In presence of hypoxia, it results in reductive carboxylation of αKG to form acetyl-CoA, which is needed for lipid synthesis. In mouse model, overexpression of the IDH1 gene causes obesity, fatty liver and hyperlipidemia. Mutations in this gene are associated with glioblastoma multiforme and acute myeloid leukemia.

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Fatty Acid Synthesis and Metabolism in Cancer Cells

Proliferatively active cells require fatty acids for functions such as membrane generation, protein modification, and bioenergetic requirements. These fatty acids are derived either from dietary sour...
Keywords: Apoptosis, Biofiles, Cancer, Carboxylations, Catalysis, Citric Acid Cycle, Gene expression, Glycolysis, Metabolism, Oxidations, PAGE, Phosphorylations

LCMS Separation and Identification of 2-Hydroxyglutarates

Sigma-Aldrich has recently developed an application for the separation and identification of S-2-hydroxyglutaric acids and R-2-hydroxyglutaric acids by chiral LC-MS, using a CHIROBIOTIC® R Column (co...
Keywords: AGE, Cancer, High performance liquid chromatography, Liquid chromatography mass spectrometry, Mass spectrometry, Metabolism, Reductions, Separation, Tools

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?