• USA Home
  • HPA038356 - Anti-PCBP2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA038356 Sigma-Aldrich

Anti-PCBP2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-HNRNPE2, Anti-HNRPE2, Anti-hnRNP-E2

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, P-PF, PB-PC, Prestige Antibodies,
species reactivity   human
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:20- 1:50
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PCBP2(5094)
biological source   rabbit
antibody product type   primary antibodies
conjugate   unconjugated
UniProt accession no.   Q15366

Description

Immunogen

poly(rC) binding protein 2 recombinant protein epitope signature tag (PrEST)

General description

Poly (rC) binding protein 2 (PCBP2), also known as heterogeneous ribonuclear protein E2 (hnRNP E2) and αCP2, belongs to a group of proteins that bind to poly(C) stretches of both RNA and DNA and is encoded by the gene mapped to human chromosome 12q13.13. The encoded protein is a key constituent of stress granules (SG) and processing bodies (P-body). The protein shuttles between cytoplasm and nucleus.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Anti-PCBP2 antibody produced in rabbit has been used in fully automated and standardized-individual-nucleotide resolution cross-linking and immunoprecipitation (FAST- iCLIP).

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Linkage

Corresponding Antigen APREST81245.

Biochem/physiol Actions

Poly (rC) binding protein 2 (PCBP2) plays a vital role in controlling mRNA stability and regulating translation 14. In addition, it can also take part in protein-protein interactions. The encoded protein functions as a negative regulator of mitochondrial antiviral-signaling protein (MAVS)-mediated antiviral signaling via interacting with HECT (homologous to the E6-AP carboxyl terminus) domain -containing E3 ligase AIP4. Dysregulated expression of the gene results in oral cancer. PCBP2 plays a vital role as an initiator of internal ribosomal entry site (IRES)-mediated translation of both viral and cellular mRNA. Additionally, it also facilitates many biological processes, such as transcriptional regulation and translational silencing. Elevated expression of PCBP2 has been observed in human glioma tissues and cell lines. Downregulation of this gene, by the inhibition of cell-cycle progression and activation of caspase-3–mediated apoptosis, retards glioma growth in vitro and in vivo.

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?