• USA Home
  • L7880 - β-Lactoglobulin A from bovine milk

L7880 Sigma

β-Lactoglobulin A from bovine milk

≥90% (PAGE)

Related Categories Mass Spectrometry, Molecular Biology, Peptide and Protein Standards for Mass Spectrometry Analysis, Proteomics
assay   ≥90% (PAGE)
mol wt   mol wt 18,363 Da by calculation
storage temp.   2-8°C

10, 25, 100, 250 mg in poly bottle

β-Lactoglobulin was used in the identification of the genetic variants of κ-casein in milk by isoelectric focusing electrophoresis.

Biochem/physiol Actions

A member of the lipocalin family, βLg is a small protein of 162 amino acids with a molecular mass of ∼18,400 Da, featuring an eight-stranded β-barrel (strands A-H) succeeded by a three-turn a-helix and a final β-strand (strand I) that forms part of the dimerization interface.

General description

Milk from dairy cows contains the protein β-lactoglobulin (BLG). It naturally occurs in a number of genetic variants, and the most prevalent bovine variants are known as BLG A and BLG B.

Price and Availability

Seppro Protein Depletion Technology

Celebrate Pi Day!
Safety & Documentation

Safety Information

NONH for all modes of transport
WGK Germany 

Certificate of Analysis

Certificate of Origin

Frequently Asked Questions

Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?
Uniprot P02754 describes beta Lactoglobulin. The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178. But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B: 1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D). 2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V). So to answer your question, the sequence of Product L7880 is: LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVF KIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Which document(s) contains shelf-life or expiration date information for a given product?
If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis. These documents are located on the product detail page under Useful Links & Tools. Click on the following link to search for a Certificate of Analysis. Please click the following link to see the details on our Product Dating Information.
How do I get lot-specific information or a Certificate of Analysis?
A Certificate of Analysis is available by lot number and can be obtained through our Advanced Search Option: http://www.sigmaaldrich.com/catalog/AdvancedSearchPage.do
How do I find price and availability?
There are several ways to find pricing and availability for our products.  Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote.  USA customers:  1-800-325-3010 or view local office numbers. 
What is the Department of Transportation shipping information for this product?
Transportation information can be found in Section 14 of the product's (M)SDS. To access the shipping information for this material, use the link on the product detail page for the product, or search here. 
My question is not addressed here, how can I contact Technical Service for assistance?
Use the option to the right to "Ask a Question" by email of a Technical Service Scientist.
Show more questions
Protocols & Articles

HPLC Analysis of Proteins on BIOshell™ A400 Protein C18, Hydrophobicity Comparision

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Proteins on BIOshell™ A400 Protein C18, Hydrophobicity Comparision
Keywords: High performance liquid chromatography

Peer-Reviewed Papers

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?