• USA Home
  • MSQC15 - SILuLite SigmaMAb Infliximab Monoclonal Antibody

EMAIL THIS PAGE TO A FRIEND
MSQC15 Sigma-Aldrich

SILuLite SigmaMAb Infliximab Monoclonal Antibody

recombinant, expressed in CHO cells

Purchase

Properties

Related Categories Antibody Characterization and Analysis, Biochemicals and Reagents, Proteins and Derivatives, SILuMAb and SigmaMAb Antibody Standards for Mass Spec Analysis
recombinant   expressed in CHO cells
assay   ≥90% (SDS-PAGE)
form   solid
suitability   suitable for mass spectrometry
shipped in   wet ice
storage temp.   −20°C

Description

General description

SigmaMAb Infliximab (MSQC15) was designed to be a standard for the analysis of Infliximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILuMab Infliximab (MSQC9).

SigmaMAb Infliximab is for R&D use only. Not for drug, household, or other uses.

Sequence

SigmaMab Infliximab Heavy Chain:
EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSAVYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Infliximab Light Chain:
DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVESEDIADYYCQQSHSWPFTFGSGTNLEVKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?