EMAIL THIS PAGE TO A FRIEND
MSQC2 Sigma-Aldrich

MS QCAL Peptide Mix

lyophilized powder

Synonym: MS Qual/Quant QC Mix

  •  NACRES NA.24

Purchase

Properties

Related Categories Amino Acid, Peptide & Protein Standards, Analytical Standards, Analytical/Chromatography, Mass Spectrometry, Molecular Biology,
form   lyophilized powder
analyte chemical class(es)   amino acids, peptides, proteins
Featured Industry   Food and Beverages
shipped in   ambient
storage temp.   2-8°C

Description

General description

QCAL was designed using the QconCAT technology and recombinantly expressed in E. coli.  The parent protein sequence of QCAL is as follows:

MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH

QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.

Application

This product is optimized to assess platform characteristics, including:
• Repeatability/Reproducibility between runs
• System stability (drift, chromatography, signal intensity, sensitivity, etc.)
• Inter- and intra- platform and lab comparisons

MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.

Features and Benefits

General

Complexity
• Defined mixture gives confidence in your instruments analysis

Components

Each vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable
Protocols & Articles

Related Content

Stable Isotope-labeled MS Internal Standards

What happens when you combine state-of-the-art technology with scientific prowess? Full-length protein standards with the highest purity and isotopic incorporation in the industry. Stable isotope-lab...
Keywords: Atomic absorption spectroscopy, Buffers, Digestions, Mass spectrometry, PAGE, Phosphorylations, Proteomics

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?