• USA Home
  • MSST0009 - SILuProt MAPK1 Mitogen Activated Protein Kinase 1 human

EMAIL THIS PAGE TO A FRIEND
MSST0009 Sigma-Aldrich

SILuProt MAPK1 Mitogen Activated Protein Kinase 1 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N -labeled

Synonym: Extracellular signal-regulated kinase 2 (Erk2), Mitogen-activated protein kinase 1 (MAPK1)

  •  NACRES NA.12

Purchase

Properties

Related Categories Biochemicals and Reagents, Proteins and Derivatives, SILuProt Protein Standards for Quantitative Mass Spectrometry More...
Quality Level   200
recombinant   expressed in HEK 293 cells
assay   ≥95% (SDS-PAGE)
form   liquid
potency   ≥98% Heavy amino acids incorporation efficiency by MS
conjugate   His tagged
suitability   suitable for mass spectrometry (standard)
UniProt accession no.   P28482
storage temp.   −20°C

Description

General description

SILuProt MAPK1 is a recombinant, stable isotope-labeled human MAPK1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of MAPK1 in mass-spectrometry. SILuProt MAPK1 is a monomer of 380 amino acids (including polyhistidine and flag tags), with an apparent molecular weight of 44 kDa.

Biochem/physiol Actions

MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear proteins (e.g., Elk-1, c-Myc, c-Jun, c-Fos, and C/EBP β). It is a protein serine/threonine kinase that is a member of the extracellular signal-regulated kinases (ERKs) which are activated in response to numerous growth factors and cytokines. Aberrations in the RAS-MAPK complex (of which MAPK1 is a downstream effector) are implicated in several human cancers, and this renders the pathway an attractive therapeutic target.

Sequence

MDYKDDDDKGHHHHHHHHGGQAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Physical form

Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety & Documentation

Safety Information

Symbol 
GHS07  GHS07
Signal word 
Warning
Hazard statements 
Precautionary statements 
RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 2
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Related Content

Stable Isotope-labeled MS Internal Standards

What happens when you combine state-of-the-art technology with scientific prowess? Full-length protein standards with the highest purity and isotopic incorporation in the industry. Stable isotope-lab...
Keywords: Atomic absorption spectroscopy, Buffers, Digestions, Mass spectrometry, PAGE, Phosphorylations

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?