• USA Home
  • MSST0033 - SILuProt COL1A1 N-terminal propeptide human

EMAIL THIS PAGE TO A FRIEND
MSST0033 Sigma-Aldrich

SILuProt COL1A1 N-terminal propeptide human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Synonym: Collagen alpha-1(I) chain, Collagenalpha-1(I)chain, P1NP

  •  NACRES NA.12

Purchase

Properties

Related Categories Biochemicals and Reagents, Proteins and Derivatives, SILuProt Protein Standards for Quantitative Mass Spectrometry More...
Quality Level   200
biological source   human
recombinant   expressed in HEK 293 cells
assay   ≥98% (SDS-PAGE)
form   lyophilized powder
potency   ≥98 Heavy amino acids incorporation efficiency by MS
application(s)   mass spectroscopy (MS): suitable
suitability   suitable for mass spectrometry (standard)
UniProt accession no.   P02452
storage temp.   −20°C
Gene Information   human ... COL1A1(1277)

Description

General description

Collagen type I is present in soft connective tissues and bone, where it constitutes more than 90% of the organic matrix.1 During bone formation collagen type I is synthesized from pro-collagen type I, which is secreted from fibroblasts and osteoblasts 2 Pro-collagen type I contains N-and C-terminal extensions, which are removed by specific proteases during the conversion of procollagen to collagen.3 Measurements of N- terminal propeptides of procollagen type I (PINP) can be of value in assessing bone formation.Recent evidence indicates that PINP can serve as a serum biomarker of bone formation, as it accurately identifies those patients who are responding to anabolic or antiresorptive therapy within 3 months of the start of treatment.4 The use of this biomarker in patients being treated for osteoporosis may significantly improve therapy adherence and clinical outcomes.4

Immunogen

QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPDYKDDDDKGHHHHHHHHGGQ

Biochem/physiol Actions

SILuProt COL1A1 is a recombinant, stable isotope-labeled human COL1A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of COL1A1 in mass-spectrometry. SILu Prot COL1A1 is a protein of 159 amino acids (Q23-P161 and including C-terminal polyhistidine and FLAG® tags) with a calculated molecular mass of 16 kDa.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

FLAG is a registered trademark of Sigma-Aldrich Co. LLC

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 2
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?